Loading...
Statistics
Advertisement

Grupa Ankara.pl
www.albumszkolny.pl/
Ankara.pl

Albumszkolny.pl

Advertisement
Conversion Technology Metas Server
Albumszkolny.pl is hosted in Poland . Albumszkolny.pl uses HTTPS protocol. Number of used technologies: 5. First technologies: CSS, Html, Iframe, Number of used javascripts: 4. First javascripts: Jquery-1.8.0.js, Jquery-1.8.0.min.js, Popup.js, Number of used analytics tools: 0. Its server type is: IdeaWebServer/v0.80.

Technologies in use by Albumszkolny.pl

Technology

Number of occurences: 5
  • CSS
  • Html
  • Iframe
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 4
  • jquery-1.8.0.js
  • jquery-1.8.0.min.js
  • popup.js
  • lightbox.js

Server Type

  • IdeaWebServer/v0.80

Social

Number of occurences: 1
  • Facebook Like box

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Albumszkolny.pl

SSL certificate

    • name: /C=PL/OU=Domain Control Validated/CN=www.ankaralab.com
    • subject:
      • C: PL
      • OU: Domain Control Validated
      • CN: www.ankaralab.com
    • hash: cd6098f1
    • issuer:
      • C: BE
      • O: GlobalSign nv-sa
      • CN: AlphaSSL CA - SHA256 - G2
    • version: 2
    • serialNumber: 1492455996378661125955608002124225849827973
    • validFrom: 151125083504Z
    • validTo: 161125083504Z
    • validFrom_time_t: 1448440504
    • validTo_time_t: 1480062904
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • certificatePolicies: Policy: 2.23.140.1.2.1 CPS: https://www.globalsign.com/repository/
      • subjectAltName: DNS:www.ankaralab.com, DNS:ankaralab.com
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • crlDistributionPoints: Full Name: URI:http://crl2.alphassl.com/gs/gsalphasha2g2.crl
      • authorityInfoAccess: CA Issuers - URI:http://secure2.alphassl.com/cacert/gsalphasha2g2r1.crt OCSP - URI:http://ocsp2.globalsign.com/gsalphasha2g2
      • subjectKeyIdentifier: CD:C8:15:64:59:3F:44:CC:50:67:B9:FF:41:3E:D9:4C:7A:1D:A1:87
      • authorityKeyIdentifier: keyid:F5:CD:D5:3C:08:50:F9:6A:4F:3A:B7:97:DA:56:83:E6:69:D2:68:F7

Meta - Albumszkolny.pl

Number of occurences: 4
  • Name:
    Content: r.roclawski@ankara.pl
  • Name: Keywords
    Content: wizytowki, wizytki, business, cards, wiz, fabryka, druk, drukowanie, ulotki, cyfra, cyfrowy, cyfr, fotografia, foto, odbitki, zabawki, toys, Gdansk, Trojmiasto, 3miasto, prof, 24h, express, lab, ankaralab, ankara, Ankara, only4kids, only, kids
  • Name: Description
    Content: Ankara.pl
  • Name: Author
    Content: Radosław Rocławski

Server / Hosting

  • IP: 89.161.250.62
  • Latitude: 52.24
  • Longitude: 21.04
  • Country: Poland

Rname

  • dns3.home.pl
  • dns2.home.pl
  • dns.home.pl
  • albumszkolny.pl

Target

  • admin.home.pl

HTTP Header Response

HTTP/1.1 200 OK Date: Mon, 23 May 2016 00:36:26 GMT Content-Type: text/html Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Pragma: no-cache Server: IdeaWebServer/v0.80 Set-Cookie: PHPSESSID=a6bccce2a6fc18fa47b323bdbfba8157; path=/ X-Cache: MISS from s_hk1 X-Cache-Lookup: MISS from s_hk1:80 Via: 1.1 s_hk1 (squid/3.5.9) Connection: keep-alive

DNS

host: albumszkolny.pl
  1. class: IN
  2. ttl: 3600
  3. type: A
  4. ip: 89.161.250.62
host: albumszkolny.pl
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: dns3.home.pl
host: albumszkolny.pl
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: dns2.home.pl
host: albumszkolny.pl
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: dns.home.pl
host: albumszkolny.pl
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: dns.home.pl
  5. rname: admin.home.pl
  6. serial: 1462336972
  7. refresh: 10800
  8. retry: 3600
  9. expire: 604800
  10. minimum-ttl: 3600
host: albumszkolny.pl
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: albumszkolny.pl

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.lbumszkolny.pl, www.aolbumszkolny.pl, www.olbumszkolny.pl, www.aplbumszkolny.pl, www.plbumszkolny.pl, www.a9lbumszkolny.pl, www.9lbumszkolny.pl, www.albumszkolny.pl, www.lbumszkolny.pl, www.ailbumszkolny.pl, www.ilbumszkolny.pl, www.aulbumszkolny.pl, www.ulbumszkolny.pl, www.abumszkolny.pl, www.alubumszkolny.pl, www.aubumszkolny.pl, www.al8bumszkolny.pl, www.a8bumszkolny.pl, www.al9bumszkolny.pl, www.a9bumszkolny.pl, www.aljbumszkolny.pl, www.ajbumszkolny.pl, www.al0bumszkolny.pl, www.a0bumszkolny.pl, www.almbumszkolny.pl, www.ambumszkolny.pl, www.alpbumszkolny.pl, www.apbumszkolny.pl, www.alobumszkolny.pl, www.aobumszkolny.pl, www.alumszkolny.pl, www.albqumszkolny.pl, www.alqumszkolny.pl, www.albwumszkolny.pl, www.alwumszkolny.pl, www.albzumszkolny.pl, www.alzumszkolny.pl, www.albxumszkolny.pl, www.alxumszkolny.pl, www.albumszkolny.pl, www.alumszkolny.pl, www.albsumszkolny.pl, www.alsumszkolny.pl, www.albyumszkolny.pl, www.alyumszkolny.pl, www.albeumszkolny.pl, www.aleumszkolny.pl, www.albdumszkolny.pl, www.aldumszkolny.pl, www.albcumszkolny.pl, www.alcumszkolny.pl, www.albmszkolny.pl, www.albuwmszkolny.pl, www.albwmszkolny.pl, www.albuemszkolny.pl, www.albemszkolny.pl, www.albusmszkolny.pl, www.albsmszkolny.pl, www.albuamszkolny.pl, www.albamszkolny.pl, www.albuszkolny.pl, www.albumpszkolny.pl, www.albupszkolny.pl, www.albumoszkolny.pl, www.albuoszkolny.pl, www.albumiszkolny.pl, www.albuiszkolny.pl, www.albumkszkolny.pl, www.albukszkolny.pl, www.album.szkolny.pl, www.albu.szkolny.pl, www.albumuszkolny.pl, www.albuuszkolny.pl, www.albumjszkolny.pl, www.albujszkolny.pl, www.albumnszkolny.pl, www.albunszkolny.pl, www.album-szkolny.pl, www.albu-szkolny.pl, www.albumzkolny.pl, www.albumsezkolny.pl, www.albumezkolny.pl, www.albumswzkolny.pl, www.albumwzkolny.pl, www.albumsdzkolny.pl, www.albumdzkolny.pl, www.albumsxzkolny.pl, www.albumxzkolny.pl, www.albumsfzkolny.pl, www.albumfzkolny.pl, www.albumsgzkolny.pl, www.albumgzkolny.pl, www.albumstzkolny.pl, www.albumtzkolny.pl, www.albumskolny.pl, www.albumsztkolny.pl, www.albumstkolny.pl, www.albumszakolny.pl, www.albumsakolny.pl, www.albumszskolny.pl, www.albumsskolny.pl, www.albumszxkolny.pl, www.albumsxkolny.pl, www.albumszckolny.pl, www.albumsckolny.pl, www.albumszgkolny.pl, www.albumsgkolny.pl, www.albumszhkolny.pl, www.albumshkolny.pl, www.albumszjkolny.pl, www.albumsjkolny.pl, www.albumszukolny.pl, www.albumsukolny.pl, www.albumszolny.pl, www.albumszktolny.pl, www.albumsztolny.pl, www.albumszkolny.pl, www.albumszolny.pl, www.albumszkgolny.pl, www.albumszgolny.pl, www.albumszkbolny.pl, www.albumszbolny.pl, www.albumszknolny.pl, www.albumsznolny.pl, www.albumszkholny.pl, www.albumszholny.pl, www.albumszkyolny.pl, www.albumszyolny.pl, www.albumszklolny.pl, www.albumszlolny.pl, www.albumszkoolny.pl, www.albumszoolny.pl, www.albumszkuolny.pl, www.albumszuolny.pl, www.albumszkiolny.pl, www.albumsziolny.pl, www.albumszkmolny.pl, www.albumszmolny.pl, www.albumszklny.pl, www.albumszkoblny.pl, www.albumszkblny.pl, www.albumszkohlny.pl, www.albumszkhlny.pl, www.albumszkoglny.pl, www.albumszkglny.pl, www.albumszkojlny.pl, www.albumszkjlny.pl, www.albumszkomlny.pl, www.albumszkmlny.pl, www.albumszko lny.pl, www.albumszk lny.pl, www.albumszkovlny.pl, www.albumszkvlny.pl, www.albumszkony.pl, www.albumszkoluny.pl, www.albumszkouny.pl, www.albumszkol8ny.pl, www.albumszko8ny.pl, www.albumszkol9ny.pl, www.albumszko9ny.pl, www.albumszkoljny.pl, www.albumszkojny.pl, www.albumszkol0ny.pl, www.albumszko0ny.pl, www.albumszkolmny.pl, www.albumszkomny.pl, www.albumszkolpny.pl, www.albumszkopny.pl, www.albumszkolony.pl, www.albumszkoony.pl,

Other websites we recently analyzed

  1. 2015 Wedding Dress Fashion Trend Inexpensive Prom Dresses
    2015 fashion wedding dresses under 100, prom dresses, evening dresses collection, the most excellent designers and professional tailors guarantee best custom made dresses.
    Los Angeles (United States) - 155.94.236.167
    Server software: Apache/2.2.15
    Technology: CSS, Html, Javascript, jQuery Validate, Wordpress
    Number of Javascript: 8
    Number of meta tags: 6
  2. Defiance College Apparel, Shop Defiance Gear, Defiance Yellow Jackets Merchandise, Store, Bookstore, Gifts, Tees, Caps, Jerseys
    Defiance College Apparel and Defiance Yellow Jackets Gear from the tremendous Defiance Yellow Jackets fan store. Our Defiance Apparel and merchandise shop will help fans prepare for football, basketball, baseball, and lacrosse season.
    Coppell (United States) - 68.91.160.27
    G Analytics ID: UA-44540413-5
    Server software: Microsoft-IIS/8.5
    Technology: BootstrapCDN, Maxcdn, AdRoll, CSS, Font Awesome, Html, Javascript, Google Analytics
    Number of Javascript: 2
    Number of meta tags: 3
  3. jeepbrasil.com.br
    Porto Alegre (Brazil) - 186.237.28.4
    Server software: Microsoft-IIS/6.0
    Technology: Html
    Number of meta tags: 1
  4. PLEASANTVIEWFAMILYHEALTHCARE.COM
    Jacksonville (United States) - 205.178.189.131
    Server software: Sun-ONE-Web-Server/6.1
    Technology: Html
    Number of meta tags: 1
  5. 1ï¼…ER TATTOO
    Japan - 210.188.245.26
    Server software: Apache
    Technology: Html, Html5
    Number of meta tags: 1
  6. Medien und Praxishilfen
    Germany - 80.86.88.175
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript
    Number of Javascript: 4
    Number of meta tags: 2
  7. sandifor.com
    Road Town (Virgin Islands, British) - 208.91.197.25
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  8. danandpro.com
    Scottsdale (United States) - 50.63.202.51
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  9. BeehiveWigs.com
    Kirkland (United States) - 98.124.245.24
    Server software: Apache/2.2.15 (CentOS)
    Technology: Google Adsense, CSS, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 3
  10. Home | Telford Junior School
    Telford Junior School
    Dublin (Ireland) - 52.30.143.40
    Server software: Apache/2.4.7 (Ubuntu)
    Technology: CSS, Html, Html5, Javascript, Php, SVG
    Number of Javascript: 7
    Number of meta tags: 7

Check Other Websites